Sequence 1: | NP_611324.1 | Gene: | GstE2 / 37107 | FlyBaseID: | FBgn0063498 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509962.1 | Gene: | gst-42 / 183911 | WormBaseID: | WBGene00001790 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 56/207 - (27%) |
---|---|---|---|
Similarity: | 90/207 - (43%) | Gaps: | 20/207 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALI 66
Fly 67 WDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEK 131
Fly 132 V--------DNIKDAYGHLENFLGDN--PYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVA 186
Fly 187 AWFERLSKLPHY 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE2 | NP_611324.1 | GstA | 5..196 | CDD:223698 | 54/200 (27%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 26/72 (36%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 26/115 (23%) | ||
gst-42 | NP_509962.1 | GST_N_Zeta | 6..77 | CDD:239340 | 25/71 (35%) |
maiA | 7..211 | CDD:273527 | 55/203 (27%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 26/118 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |