DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Gstz1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:193 Identity:55/193 - (28%)
Similarity:88/193 - (45%) Gaps:20/193 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLL--AGDHFKDAFLKKNPQHTVPLLEDNGALI 66
            |.:||....|......::.|....:|||...::|:  .|..|.:.|...||...||.|:.:|..|
Mouse     5 KPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITI 69

  Fly    67 WDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFD--ASILFMSLRNVSIPYFLRQV----S 125
            ..|.||:.|| ::......|.|:|...||.|  |:..|  ||.: ..|:|:|:   |:||    .
Mouse    70 VQSLAIMEYL-EETRPIPRLLPQDPQKRAIV--RMISDLIASGI-QPLQNLSV---LKQVGQENQ 127

  Fly   126 LVPKEKVDNIKDAYGHLENFLGD--NPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVA 186
            :...:||  |...:..||..|..  ..|..|.::::||:|.....:: |....:|...||.::
Mouse   128 MQWAQKV--ITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVAN-AERFKVDLSPYPTIS 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 54/192 (28%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/74 (31%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/101 (28%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 23/74 (31%)
maiA 7..211 CDD:273527 54/191 (28%)
Glutathione binding 14..19 1/4 (25%)