DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Gsto1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:238 Identity:58/238 - (24%)
Similarity:98/238 - (41%) Gaps:68/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDN-GALIWDSH 70
            :|.|...|..:...:.|:|..:.:|...::|   .:..:.|.:|||...||:||:: |.|:.:| 
Mouse    26 VYSMRFCPFAQRTLMVLKAKGIRHEVININL---KNKPEWFFEKNPLGLVPVLENSQGHLVTES- 86

  Fly    71 AIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVS-----IPYFLRQVSLVPKE 130
            .|.|..:|:.....:|:|.|...:|:  |:         |:|.:.|     |..|:|...   ||
Mouse    87 VITCEYLDEAYPEKKLFPDDPYKKAR--QK---------MTLESFSKVPPLIASFVRSKR---KE 137

  Fly   131 KVDNIKDAYGHLEN--------------FL-GDNP----YLTG---SQLTIADL--CCGATASSL 171
            ...|:::|   |||              || ||:|    |||.   .:|...:|  |...|    
Mouse   138 DSPNLREA---LENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWFQRLEALELKECLAHT---- 195

  Fly   172 AAVLDLDELKYPKVAAWFERLSKLPHYEEDNL--RGLKKYINL 212
                       ||:..|...:.:.|......:  :..::|:||
Mouse   196 -----------PKLKLWMAAMQQDPVASSHKIDAKTYREYLNL 227

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 54/218 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/71 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/145 (21%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 20/71 (28%)
GstA 26..224 CDD:223698 55/233 (24%)