Sequence 1: | NP_611324.1 | Gene: | GstE2 / 37107 | FlyBaseID: | FBgn0063498 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011241675.1 | Gene: | Gstt2 / 14872 | MGIID: | 106188 | Length: | 251 | Species: | Mus musculus |
Alignment Length: | 213 | Identity: | 66/213 - (30%) |
---|---|---|---|
Similarity: | 101/213 - (47%) | Gaps: | 36/213 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD- 68
Fly 69 ------SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDA-------SILFMSLRNVSIPYF 120
Fly 121 LRQVSLVPKEKVDNIKD----AYGHLEN-FLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDEL 180
Fly 181 KY------PKVAAWFERL 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE2 | NP_611324.1 | GstA | 5..196 | CDD:223698 | 66/213 (31%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 22/79 (28%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 37/117 (32%) | ||
Gstt2 | XP_011241675.1 | GST_N_Theta | 3..85 | CDD:239348 | 22/81 (27%) |
GST_C_Theta | 98..223 | CDD:198292 | 37/118 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844538 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.750 |