Sequence 1: | NP_611324.1 | Gene: | GstE2 / 37107 | FlyBaseID: | FBgn0063498 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034397.1 | Gene: | Gdap1 / 14545 | MGIID: | 1338002 | Length: | 358 | Species: | Mus musculus |
Alignment Length: | 272 | Identity: | 50/272 - (18%) |
---|---|---|---|
Similarity: | 89/272 - (32%) | Gaps: | 94/272 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDS 69
Fly 70 HAIVCYL-----------------------------------VDKYANSDELYPRDLV------- 92
Fly 93 ----LRAQVDQRLFFDASILFMSLRNVSI--PYFLRQVSLVPK----EKVDNIKDAYGHLENFL- 146
Fly 147 ----------------GDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKY------------- 182
Fly 183 PKVAAWFERLSK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE2 | NP_611324.1 | GstA | 5..196 | CDD:223698 | 50/272 (18%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 18/107 (17%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 27/137 (20%) | ||
Gdap1 | NP_034397.1 | GST_N_GDAP1 | 26..98 | CDD:239350 | 17/71 (24%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 24/116 (21%) | ||
Required for mitochondrial localization. /evidence=ECO:0000250 | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844849 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |