DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTO2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:194 Identity:51/194 - (26%)
Similarity:87/194 - (44%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGA-LIWDSH 70
            :|.|...|.....:|.|:|.::.:|...::|   .:..:.:..|:|...:|:||.:.. ||::| 
Human    26 IYSMRFCPYSHRTRLVLKAKDIRHEVVNINL---RNKPEWYYTKHPFGHIPVLETSQCQLIYES- 86

  Fly    71 AIVC-YLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQ--VSLVPKEKV 132
            .|.| ||.|.|... :|:|.|...||:  |::..:   ||     ..:|:..::  |:|....:.
Human    87 VIACEYLDDAYPGR-KLFPYDPYERAR--QKMLLE---LF-----CKVPHLTKECLVALRCGREC 140

  Fly   133 DNIKDA----YGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERL 192
            .|:|.|    :.:||..|   .|...:..       |.|..|:     :|.|.:|    |||||
Human   141 TNLKAALRQEFSNLEEIL---EYQNTTFF-------GGTCISM-----IDYLLWP----WFERL 185

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 51/194 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/105 (25%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 19/71 (27%)