DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstE2 and CLIC2

DIOPT Version :9

Sequence 1:	NP_611324.1	Gene:	GstE2 / 37107	FlyBaseID:	FBgn0063498	Length:	221	Species:	Drosophila melanogaster
Sequence 2:	NP_001280.3	Gene:	CLIC2 / 1193	HGNCID:	2063	Length:	247	Species:	Homo sapiens

Alignment Length:	144	Identity:	36/144 - (25%)
Similarity:	52/144 - (36%)	Gaps:	44/144 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    12 ISPPVRACKLTLRALNLDYEYKE-----MDLLA--GDHFKDAFLKKNPQHTVPLLEDNGALIWDS 69
            ::||        |..:|..:|||     .:|.|  ..:.|:...:.|......||::...|
Human    94 LAPP--------RYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRL---- 146

  Fly    70 HAIVCYLVDKYANS---DELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEK 131
                    |.|.|:   ||:.| |......|.:|||.|...|           .|...||:||..
Human   147 --------DDYLNTPLLDEIDP-DSAEEPPVSRRLFLDGDQL-----------TLADCSLLPKLN 191

  Fly   132 VDNIKDAYGHLENF 145
            :  ||.|.....:|
Human   192 I--IKVAAKKYRDF 203

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstE2	NP_611324.1	GstA	5..196	CDD:223698	36/144 (25%)
		GST_N_Delta_Epsilon	5..78	CDD:239343	14/72 (19%)
		GST_C_Delta_Epsilon	94..209	CDD:198287	15/52 (29%)
CLIC2	NP_001280.3	Required for insertion into the membrane. /evidence=ECO:0000250	1..96		0/1 (0%)
		N-terminal	1..94		36/144 (25%)
		O-ClC	12..245	CDD:129941	36/144 (25%)
		Joint loop	95..106		4/18 (22%)
		C-terminal	107..247		31/123 (25%)
		Foot loop	151..171		6/20 (30%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165154406
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930