Sequence 1: | NP_611324.1 | Gene: | GstE2 / 37107 | FlyBaseID: | FBgn0063498 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009303556.1 | Gene: | LOC100333907 / 100333907 | -ID: | - | Length: | 249 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 46/204 - (22%) |
---|---|---|---|
Similarity: | 76/204 - (37%) | Gaps: | 58/204 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 LDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLV 92
Fly 93 LR------AQVDQRLFFDASI--------------LFMSLRNVSIPYFLRQVSLVPKEKVDNIKD 137
Fly 138 AYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYEEDN 202
Fly 203 LRGLKKYIN 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE2 | NP_611324.1 | GstA | 5..196 | CDD:223698 | 42/187 (22%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 13/49 (27%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 28/134 (21%) | ||
LOC100333907 | XP_009303556.1 | O-ClC | 14..249 | CDD:129941 | 46/204 (23%) |
GST_N_CLIC | 14..101 | CDD:239359 | 13/58 (22%) | ||
GST_C_family | 108..248 | CDD:295467 | 30/137 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589514 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |