DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and LOC100333907

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_009303556.1 Gene:LOC100333907 / 100333907 -ID:- Length:249 Species:Danio rerio


Alignment Length:204 Identity:46/204 - (22%)
Similarity:76/204 - (37%) Gaps:58/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLV 92
            :|.:.|..||      :|.....||    |.:..||.::.|.:.|..:|.::.....  ||: |.
Zfish    54 VDLKRKPADL------QDLAPGTNP----PFMTFNGEVLVDVNKIEEFLEERLGPPQ--YPK-LA 105

  Fly    93 LR------AQVDQRLFFDASI--------------LFMSLRNVSIPYFLRQVSLVPKEKVDNIKD 137
            .:      |.:|....|.|.|              |..||:.:. .|.  |..|..:...|:::|
Zfish   106 TKHPESNTAGIDVFAKFSAYIKNPRKEANEGLEKALLKSLKRLD-EYL--QTPLPEEIDADSLED 167

  Fly   138 AYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYEEDN 202
            ......:|      |.|.:||:||  |..          |.:|...|:.|...|..::|    ..
Zfish   168 PGASTRSF------LDGDELTLAD--CNL----------LPKLHIIKIVARKYRGLEIP----AE 210

  Fly   203 LRGLKKYIN 211
            :.|:.:|:|
Zfish   211 MSGIWRYLN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 42/187 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 13/49 (27%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/134 (21%)
LOC100333907XP_009303556.1 O-ClC 14..249 CDD:129941 46/204 (23%)
GST_N_CLIC 14..101 CDD:239359 13/58 (22%)
GST_C_family 108..248 CDD:295467 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.