DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and URE2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:62/236 - (26%)
Similarity:94/236 - (39%) Gaps:46/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNG---TF 66
            |..|:....:|....|.:.|..|...|....::...|||.:.|:|..||...||.|.|:|   ..
Yeast   113 GYTLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLS 177

  Fly    67 IWDSHAIAAYLVDKYAK---SDELYPKDLAKRAIVNQRLFFDASVIYASIANV--SRPFWINGVT 126
            ||:|.||..:||:||.|   :..|:..|||.::.:|..|||..|.....|...  .|.|....:.
Yeast   178 IWESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIA 242

  Fly   127 EVPQEKLDAVHQGLKLLETFL---------------------GNSP-----------YLAGDSLT 159
            ...:...|.|.:...::|..|                     |.:|           :|.||.||
Yeast   243 SAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLT 307

  Fly   160 LADLSTGP---TVSAVPAAVDIDPATYPKVTAWLDRLNKLP 197
            :|||:..|   .|..:...:.|:   :|:|..|...:.:.|
Yeast   308 IADLAFVPWNNVVDRIGINIKIE---FPEVYKWTKHMMRRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 24/75 (32%)
GstA 8..197 CDD:223698 60/231 (26%)
GST_C_Delta_Epsilon 94..210 CDD:198287 29/141 (21%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 27/79 (34%)
GST_C_Ure2p 208..350 CDD:198326 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.