DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GTT1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:54/235 - (22%)
Similarity:93/235 - (39%) Gaps:41/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYE---YK-EVNLQAGEHLSEEYVKKNPQHTVPMLD 61
            ||...|.::..|.|...|.:.| |..|||:||   || :.|.:|...|.    |.:|....|:|:
Yeast     1 MSLPIIKVHWLDHSRAFRLLWL-LDHLNLEYEIVPYKRDANFRAPPELK----KIHPLGRSPLLE 60

  Fly    62 --DNGT----FIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFF-DASV--------IYA 111
              |..|    .:.:|..|..|::..:..|..|..:|......:|..||: :.|:        |.:
Yeast    61 VQDRETGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILS 125

  Fly   112 SIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETF-------LGNSPYLAGDSLTLADLSTGPTV 169
            .:.:...||.|:.:.....:|:...:...::...|       ..|:.||....|:.||:     :
Yeast   126 KVKDSGMPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADI-----L 185

  Fly   170 SAVPAAVDID-----PATYPKVTAWLDRLNKLPYYKEINE 204
            .:.|..:..:     |..||.::.||..:.....|....|
Yeast   186 MSFPLQMAFERKFAAPEDYPAISKWLKTITSEESYAASKE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 25/82 (30%)
GstA 8..197 CDD:223698 49/219 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 24/132 (18%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 25/85 (29%)
GST_C_GTT1_like 93..218 CDD:198298 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.