DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and TEF4

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:197 Identity:42/197 - (21%)
Similarity:85/197 - (43%) Gaps:39/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSD 85
            ||.:|:::|:        |:.|..|...:|:.|    ..|...|..:.::.||..||.::.|...
Yeast    25 KLDVKIVDLE--------QSSEFASLFPLKQAP----AFLGPKGLKLTEALAIQFYLANQVADEK 77

  Fly    86 E---LYPKDLAKRAIVNQRLFFDASVIYASIA------NVSRPFW-INGVTEVPQEKLDA----V 136
            |   |...|:.:::.:         :.:||:|      |::|||. ..|:....::.:||    :
Yeast    78 ERARLLGSDVIEKSQI---------LRWASLANSDVMSNIARPFLSFKGLIPYNKKDVDACFVKI 133

  Fly   137 HQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDP---ATYPKVTAWLDRLNKLPY 198
            .....:.:..|.:..::|.::::|.||....: .|...|..:.|   |.:|.:..|.:.:...|.
Yeast   134 DNLAAVFDARLRDYTFVATENISLGDLHAAGS-WAFGLATILGPEWRAKHPHLMRWFNTVAASPI 197

  Fly   199 YK 200
            .|
Yeast   198 VK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 15/57 (26%)
GstA 8..197 CDD:223698 40/192 (21%)
GST_C_Delta_Epsilon 94..210 CDD:198287 23/121 (19%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 15/58 (26%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 23/121 (19%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345111
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.