DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GTT2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:61/223 - (27%)
Similarity:100/223 - (44%) Gaps:28/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNL--DYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLD-DNGTFI 67
            :::|.|...|....|::.|...|:  ..::..:||..|||...|::.||...|||:|: |:||.|
Yeast    19 MIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTLI 83

  Fly    68 WDSHAIAAYLVDKYAKSDELYPKDLAKRAIV---NQRL---FFDASVIYASIANVSRPFWINGVT 126
            .:..||..| :|....:..|..|...::.::   |:|.   ..|...:|...|...    :....
Yeast    84 AECTAITEY-IDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPG----LGPEV 143

  Fly   127 EVPQEK------LDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSA---VPAAVDID-PA 181
            |:.|.|      .|....|:...:|.|...||:||||.::||:    ||.|   ..|.|.:. |.
Yeast   144 ELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADI----TVIAGLIFAAIVKLQVPE 204

  Fly   182 TYPKVTAWLDRLNKLPYYKEINEAPAQS 209
            ....:.||..|:.:.|..|::.|..::|
Yeast   205 ECEALRAWYKRMQQRPSVKKLLEIRSKS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 25/75 (33%)
GstA 8..197 CDD:223698 57/207 (28%)
GST_C_Delta_Epsilon 94..210 CDD:198287 33/132 (25%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 25/75 (33%)
GST_C_GTT2_like 106..222 CDD:198291 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345150
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.