DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and AT1G66235

DIOPT Version :10

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_683473.2 Gene:AT1G66235 / 842939 AraportID:AT1G66235 Length:284 Species:Arabidopsis thaliana


Alignment Length:97 Identity:22/97 - (22%)
Similarity:38/97 - (39%) Gaps:34/97 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 AKSDELYPKDLAKRAIVNQRLF-----FDASVIYASIANVSRPF--WINGVTE---------VPQ 130
            |.||:::  :.||..::..:.|     ||      .:.|:.|.|  :.:|.|:         :..
plant    90 ASSDDIF--NQAKEMLMQDKHFKSGWKFD------HVWNIIRNFEKFKDGATQAKKVLNLCGLEN 146

  Fly   131 EKLDAVHQ----------GLKLLETFLGNSPY 152
            ..||:|.|          .|...:..:|.|||
plant   147 PTLDSVSQASSGSFSFSLNLDDEDDIIGRSPY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GstA 6..201 CDD:440390 22/97 (23%)
AT1G66235NP_683473.2 NAM-associated 114..266 CDD:464129 16/71 (23%)

Return to query results.
Submit another query.