DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTF14

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:185 Identity:55/185 - (29%)
Similarity:93/185 - (50%) Gaps:20/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDYEYKEVNLQAGEHLSEEYVKK-NPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAK-SDELYPKD 91
            ||:|...|:..|||..::.::.. ||...||:|:|....:::..||..||.::|.. ...|.|.|
plant    28 LDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYKDVGTNLLPDD 92

  Fly    92 LAKRAIVNQRLFFDASVIYASIANVSRPFWIN---GV----TEVPQEKLDAVHQGLKLLETFLGN 149
            ..||||::..:..|::......:.:.:...||   |:    |.| ||..:.:.:.|.:.||.||.
plant    93 PKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGLATDDTAV-QENKEKLSEVLNIYETRLGE 156

  Fly   150 SPYLAGDSLTLADLSTGPTVSAVPAAVDIDPA-------TYPKVTAWLDRLNKLP 197
            ||||||:|.:||||.   .::.:...::.|..       :.|.|.||::::...|
plant   157 SPYLAGESFSLADLH---HLAPIDYLLNTDEEELKNLIYSRPNVAAWVEKMKMRP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 17/50 (34%)
GstA 8..197 CDD:223698 54/183 (30%)
GST_C_Delta_Epsilon 94..210 CDD:198287 34/118 (29%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 17/51 (33%)
GST_C_Phi 94..214 CDD:198296 34/119 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.