DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and clic3

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:171 Identity:40/171 - (23%)
Similarity:65/171 - (38%) Gaps:38/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVS 117
            |....|.|..||....|::.|..:|.|..|...  |||...:....|..   ...:.:...|.:.
Zfish    59 PGSQPPFLIYNGEVRTDTNKIEEFLEDTLAPPQ--YPKLCCRYKESNTA---GDDIFHKFSAYIK 118

  Fly   118 RPFWIN-GVTEVPQEKLDAVHQGLKLLETFLGNSP---------------YLAGDSLTLADLSTG 166
            .|   | |:.::.::|.  :...:||.:..|...|               ||.|::|:|||.:..
Zfish   119 NP---NPGLNDMLEKKF--LKSLMKLDQYLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLL 178

  Fly   167 PTVSAVPA------AVDIDPATYPKVTAWLDRLNKLPYYKE 201
            |.:..|..      ..:| ||....::.:||:.     |||
Zfish   179 PKLHIVKVVCKKYRGFEI-PAELKGLSKYLDKA-----YKE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 8/25 (32%)
GstA 8..197 CDD:223698 37/165 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 27/130 (21%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 10/34 (29%)
O-ClC 6..237 CDD:129941 40/171 (23%)
GST_C_CLIC3 99..231 CDD:198332 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.