DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTF5

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:220 Identity:53/220 - (24%)
Similarity:85/220 - (38%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            :||...|...|.|...|....|.|:...|||.||:.....::..||...||:..|.|..:.:|.|
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    73 IAAYLVDKYAKSDELYPKDLAKRAIVNQRLF-------FDASVIYASIANVSRPFW-------IN 123
            |:.|:...:...........:.:.:..||::       ||......:.....:|.:       :.
plant   131 ISEYIATVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMYGLKTDYKVV 195

  Fly   124 GVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPAT------ 182
            ..||...||:      |.:.|..|.||.:||.:|.|:|||...|.:..:     :|..|      
plant   196 NETEAKLEKV------LDIYEERLKNSSFLASNSFTMADLYHLPNIQYL-----MDTHTKRMFVN 249

  Fly   183 YPKVTAWLDRLNKLPYYKEINEAPA 207
            .|.|..|:..:...|.:|...:..|
plant   250 RPSVRRWVAEITARPAWKRACDVKA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 23/70 (33%)
GstA 8..197 CDD:223698 50/208 (24%)
GST_C_Delta_Epsilon 94..210 CDD:198287 30/134 (22%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 23/69 (33%)
GST_C_Phi 153..270 CDD:198296 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.