DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTF7

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:223 Identity:65/223 - (29%)
Similarity:100/223 - (44%) Gaps:40/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIW 68
            :||.::|...|...|.|.:.|...|||:|:..:.|:.|||..|.::.:||...||..:|....::
plant     2 AGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLF 66

  Fly    69 DSHAIAAYLVDKYA-KSDELY---PKDLAKRAI-----------VNQRLFFDASVIYASIANVSR 118
            :|.||..|:...|: |.::|.   .||:|..|:           |..:|.::         .|.:
plant    67 ESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWE---------QVLK 122

  Fly   119 PFWINGVT------EVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVS---AVPA 174
            |.:  |:|      |..:.||..|   |.:.|..||.|.|||.|..||.||.|.|.:.   ..|.
plant   123 PLY--GMTTDKTVVEEEEAKLAKV---LDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPT 182

  Fly   175 AVDIDPATYPKVTAWLDRLNKLPYYKEI 202
            ....|..  |.|:||:..:...|..|::
plant   183 KKLFDER--PHVSAWVADITSRPSAKKV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 24/72 (33%)
GstA 8..197 CDD:223698 61/212 (29%)
GST_C_Delta_Epsilon 94..210 CDD:198287 34/129 (26%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 24/72 (33%)
GST_C_Phi 95..209 CDD:198296 35/130 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.