DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Clic4

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:184 Identity:41/184 - (22%)
Similarity:62/184 - (33%) Gaps:67/184 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVD-- 79
            |.||.|..|..:|.      ||..|.|             .|.:..|.....|.:.|..:|.:  
  Rat    54 VTTVDLKRKPAHLQ------NLAPGTH-------------PPFITFNSEVKTDVNKIEEFLEEVL 99

  Fly    80 ---KYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQG-- 139
               ||.|....:|:        :.....|....:::....|||           |..:|:.:|  
  Rat   100 CPPKYLKLSPKHPE--------SNTAGMDIFAKFSAYIKNSRP-----------EANEALERGLL 145

  Fly   140 --LKLLETFLGNSP-------------------YLAGDSLTLADLSTGPTVSAV 172
              |:.|:.:| |||                   :|.||.:||||.:..|.:..|
  Rat   146 KTLQKLDEYL-NSPLPGEIDENSMEDIKSSTRRFLDGDEMTLADCNLLPKLHIV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 15/61 (25%)
GstA 8..197 CDD:223698 41/184 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 22/102 (22%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 15/65 (23%)
GST_N_CLIC 14..104 CDD:239359 15/68 (22%)
O-ClC 17..252 CDD:129941 41/184 (22%)
GST_C_family 111..251 CDD:295467 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.