DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTT3

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:215 Identity:56/215 - (26%)
Similarity:98/215 - (45%) Gaps:20/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            :|...:|...|.|.:..||..:.::...:.|...:.||.|:...||...||.:.|....:.:|||
plant     5 VYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSESHA 69

  Fly    73 IAAYLVDKY-AKSDELYPKDLAKRAIVNQRLFFD--------ASVIYASIANVSRPFWINGVTEV 128
            |..||...| :..|..||.||:|||.::..|.:.        |..:..|:...:....:|.....
plant    70 ILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPKAAA 134

  Fly   129 PQEKLDAVHQGLKLLETF--LGNSPYLAGDSL-TLADLSTGPTVSAVPAAVDIDP----ATYPKV 186
            ..|:|  :.:.|..|:||  .||:.:|.|.:. ::||||....::.:....|.|.    :.:..|
plant   135 EAEQL--LTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRLLSPHKNV 197

  Fly   187 TAWLDRLNK--LPYYKEINE 204
            ..|::...|  :|::.|::|
plant   198 EQWIENTRKATMPHFDEVHE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/70 (30%)
GstA 8..197 CDD:223698 53/206 (26%)
GST_C_Delta_Epsilon 94..210 CDD:198287 29/128 (23%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 52/198 (26%)
GST_N_Theta 3..78 CDD:239348 21/72 (29%)
GST_C_Theta 92..221 CDD:198292 29/128 (23%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.