DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTT1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:215 Identity:58/215 - (26%)
Similarity:101/215 - (46%) Gaps:20/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            :|...:|...|.|.:..||..:.::...::|...:.||.|:...||...||.:.|....:::|||
plant     6 VYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKLFESHA 70

  Fly    73 IAAYLVDKY-AKSDELYPKDLAKRAIVNQRLFFD--------ASVIYASIANVSRPFWINGVTEV 128
            |..||...: :.:|..||.||:|||.::..|.:.        |..:..|:...:....:|.....
plant    71 ILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPLNPKAAA 135

  Fly   129 PQEKLDAVHQGLKLLETF--LGNSPYLAGDSL-TLADLSTGPTVSAVPAAVDIDP----ATYPKV 186
            ..|:|  :.:.|..||||  .||:.:|.|.:. ::||||....:..:....|.|.    :|:.||
plant   136 EAEQL--LTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLSTHKKV 198

  Fly   187 TAWLDRLNK--LPYYKEINE 204
            ..|::...|  :|::.|.:|
plant   199 EQWIENTKKATMPHFDETHE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/70 (30%)
GstA 8..197 CDD:223698 55/206 (27%)
GST_C_Delta_Epsilon 94..210 CDD:198287 32/128 (25%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 21/72 (29%)
GST_C_Theta 93..223 CDD:198292 32/128 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.