DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTF12

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:228 Identity:61/228 - (26%)
Similarity:110/228 - (48%) Gaps:34/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDS 70
            :.|||...:.|.:.|.|......:::|...::|...|....|::.:.|...||.::|....:::|
plant     3 VKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFES 67

  Fly    71 HAIAAYLVDKYA-KSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQ--EK 132
            .|||.|...|:| :...|..|.|..||||:|  :.|....|.::  :::|..||.:.: |:  ||
plant    68 RAIARYYATKFADQGTNLLGKSLEHRAIVDQ--WADVETYYFNV--LAQPLVINLIIK-PRLGEK 127

  Fly   133 LDAV-HQGLK-----LLETF---LGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTA 188
            .|.| .:.||     :|:.:   |.::.:|||:..|:|||:..|.:..:.:..||:...  |...
plant   128 CDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMV--KARG 190

  Fly   189 WLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKL 221
            ..:|     :::||::.|:          |.||
plant   191 SFNR-----WWEEISDRPS----------WKKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 19/72 (26%)
GstA 8..197 CDD:223698 55/200 (28%)
GST_C_Delta_Epsilon 94..210 CDD:198287 34/126 (27%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 61/228 (27%)
GST_N_Phi 2..77 CDD:239351 19/73 (26%)
GST_C_Phi 91..209 CDD:198296 37/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.