DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTF2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:218 Identity:58/218 - (26%)
Similarity:95/218 - (43%) Gaps:27/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIW 68
            :||.::|...|...|.|.:.|...|||:|...|.|:.|||..|.::.:||...||..:|....::
plant     2 AGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLF 66

  Fly    69 DSHAIAAYLVDKYAKSD----ELYPKDLAKRAI--------------VNQRLFFDASVIYASIAN 115
            :|.||..|:..:|....    :...|::::.||              |..:|.|:.  |:.||..
plant    67 ESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQ--IFKSIYG 129

  Fly   116 VSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDP 180
            ::..   ..|....:.||..|   |.:.|..|....||||::.||.||...|.:..:........
plant   130 LTTD---EAVVAEEEAKLAKV---LDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKL 188

  Fly   181 AT-YPKVTAWLDRLNKLPYYKEI 202
            .| .|:|..|:..:.|.|..:::
plant   189 FTERPRVNEWVAEITKRPASEKV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 25/72 (35%)
GstA 8..197 CDD:223698 55/207 (27%)
GST_C_Delta_Epsilon 94..210 CDD:198287 30/124 (24%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 25/73 (34%)
GST_C_Phi 96..211 CDD:198296 30/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.