DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and AT3G47680

DIOPT Version :10

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_190352.1 Gene:AT3G47680 / 823922 AraportID:AT3G47680 Length:302 Species:Arabidopsis thaliana


Alignment Length:70 Identity:13/70 - (18%)
Similarity:25/70 - (35%) Gaps:7/70 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 AGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKW 218
            ||:.|.|.......:..||........|.:.::.|:.....||       ....:.....::.:|
plant    52 AGEDLVLVSAWLNTSKDAVIGNEQKGYAFWSRIAAYYGASPKL-------NGVEKRETGHIKQRW 109

  Fly   219 TKLGD 223
            ||:.:
plant   110 TKINE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GstA 6..201 CDD:440390 10/46 (22%)
AT3G47680NP_190352.1 None

Return to query results.
Submit another query.