DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTF8

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:225 Identity:65/225 - (28%)
Similarity:109/225 - (48%) Gaps:22/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSGIVL-----YGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLD 61
            |||.|::     :|..:|.....|..||...:|.:|...|:::||.|..|.::..||...:|.|:
plant    43 SSSSIIMASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALE 107

  Fly    62 DNGTFIWDSHAIAAYLVDKYA-KSDELYPKDLAK-RAIVNQRL-----FFDASVIYASIANVSRP 119
            |....:::|.||..||.::|: |.::|..:|..| :|..|..|     .||.:....:...|.:.
plant   108 DGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKG 172

  Fly   120 FWINGVTEVP---QEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVS---AVPAAVDI 178
            .:  |:|..|   ||....:.:.|.:.|..|..|.:|||||.|||||...|.:.   ...:.|..
plant   173 MF--GMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLF 235

  Fly   179 DPATYPKVTAWLDRLNKLPYYKEINEAPAQ 208
            |  :.|||:.|:.:::..|.:.::.:...|
plant   236 D--SRPKVSEWIKKISARPAWAKVIDLQKQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 23/77 (30%)
GstA 8..197 CDD:223698 59/206 (29%)
GST_C_Delta_Epsilon 94..210 CDD:198287 35/127 (28%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.