DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTF3

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:213 Identity:58/213 - (27%)
Similarity:99/213 - (46%) Gaps:17/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIW 68
            :||.::|...|...|.|.:.|...|||:|...|.|:.|||..|.::.:||...||..:|....::
plant     2 AGIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLF 66

  Fly    69 DSHAIAAYLVDKYA-KSDELYP---KDLAKRAIVNQRLFFDASVIYASIANVSRPFW-------- 121
            :|.||..|:..:|. :...|.|   |::|:.||::..:..:|.. :..:|  |:..|        
plant    67 ESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQ-FDPVA--SKLAWEQVFKFNY 128

  Fly   122 -INGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPAT-YP 184
             :|....|..|:...:.:.|.:.|..|....||||::.||.||...|.:..:.........| .|
plant   129 GLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLFTERP 193

  Fly   185 KVTAWLDRLNKLPYYKEI 202
            :|..|:..:.|.|..:::
plant   194 RVNEWVAEITKRPASEKV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 25/72 (35%)
GstA 8..197 CDD:223698 55/202 (27%)
GST_C_Delta_Epsilon 94..210 CDD:198287 27/119 (23%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 57/211 (27%)
GST_N_Phi 4..78 CDD:239351 25/73 (34%)
GST_C_Phi 96..212 CDD:198296 27/119 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.