DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Gstt4

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus


Alignment Length:225 Identity:65/225 - (28%)
Similarity:103/225 - (45%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GIVLYGTDLS-PCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIW 68
            |:.||...|| || |.|.:..:...:.::::.|:|..|.|.|:||::.||...:|.|.|....:.
Mouse     2 GLELYMDLLSAPC-RAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDGKFILS 65

  Fly    69 DSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGV------TE 127
            :|.||..||..||:.....||.||..||.|::.:.:..:.|...::.:   .||..:      .|
Mouse    66 ESVAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKI---LWIKLIIPMITGEE 127

  Fly   128 VPQEK----LDAVHQGLKLL-ETFLGNSPYLAGDSLTLADLSTGPTVSAV----PAAVDIDPATY 183
            ||.|:    ||.|.:.|:.. |.||.:..::.||.::||||     |:.|    |...:.:....
Mouse   128 VPTERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADL-----VALVEMMQPMGSNHNVFVS 187

  Fly   184 PKVTAWL----------------DRLNKLP 197
            .|:..|.                :||.|||
Mouse   188 SKLAEWRMRVELAIGSGLFWEAHERLVKLP 217

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 25/73 (34%)
GstA 8..197 CDD:223698 62/220 (28%)
GST_C_Delta_Epsilon 94..210 CDD:198287 33/135 (24%)
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 54/175 (31%)
GST_N_Theta 3..78 CDD:239348 25/75 (33%)