| Sequence 1: | NP_611323.1 | Gene: | GstE1 / 37106 | FlyBaseID: | FBgn0034335 | Length: | 224 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005249419.1 | Gene: | VARS1 / 7407 | HGNCID: | 12651 | Length: | 1265 | Species: | Homo sapiens |
| Alignment Length: | 202 | Identity: | 48/202 - (23%) |
|---|---|---|---|
| Similarity: | 79/202 - (39%) | Gaps: | 41/202 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 PQHTVPMLDD--NGTFIWDSHAIAAYLVDKYAKSDELYPKDL-----AKRAIVNQR--LFFDASV 108
Fly 109 IYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVP 173
Fly 174 AAVDIDPAT---YPKVTAWLDRLNKLPYYKEI------------------NEAPAQSYVAFLRSK 217
Fly 218 WTKLGDK 224 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE1 | NP_611323.1 | GST_N_Delta_Epsilon | 6..79 | CDD:239343 | 7/27 (26%) |
| GstA | 8..197 | CDD:223698 | 39/155 (25%) | ||
| GST_C_Delta_Epsilon | 94..210 | CDD:198287 | 34/138 (25%) | ||
| VARS1 | XP_005249419.1 | GstA | <56..203 | CDD:223698 | 39/157 (25%) |
| GST_C_ValRS_N | 92..213 | CDD:198327 | 30/121 (25%) | ||
| PTZ00419 | 283..1265 | CDD:240411 | |||
| ValRS_core | 336..939 | CDD:185677 | |||
| tRNA-synt_1_2 | 514..>610 | CDD:290334 | |||
| Anticodon_Ia_Val | 939..1076 | CDD:153416 | |||
| Val_tRNA-synt_C | 1197..1259 | CDD:287436 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||