DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gstr

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:233 Identity:57/233 - (24%)
Similarity:107/233 - (45%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSGIVLYGTDLSPCVR-TVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNG 64
            |:.:.::.:||...||.| .:.|..|.|. .|::|.::....||.|.|....||:..:|......
Zfish     1 MAQNMLLYWGTGSPPCWRLMIALEEKQLQ-GYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGE 64

  Fly    65 TFIWDSHAIAAYLVDKY-AKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEV 128
            ..:.:|.|...||...: ::...|.|.:.|:.|:|.||: |:...:...:..|:...|:     |
Zfish    65 IVVNESFAACLYLESVFKSQGTRLIPDNPAEMALVYQRM-FETENLQQKMYEVAFYDWL-----V 123

  Fly   129 PQ-EKLDA--------VHQGLKLLETFL---GNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPA 181
            |: |:|::        :.:.|||.|.:|   |...||||.:.::||:...|.:           |
Zfish   124 PEGERLESALKRNKEKLIEELKLWEGYLEKMGKGSYLAGKNFSMADVVCFPVI-----------A 177

  Fly   182 TYPKVTAWLDRLNKL-PYYKEINEAPAQSYVAFLRSKW 218
            .:|::....:|..:| .||:.:.:.|:      :::.|
Zfish   178 YFPRLQCPKERCPRLMEYYEMVKDRPS------IKASW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/73 (29%)
GstA 8..197 CDD:223698 52/203 (26%)
GST_C_Delta_Epsilon 94..210 CDD:198287 31/128 (24%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 55/225 (24%)
GST_N_family 5..78 CDD:238319 20/73 (27%)
GST_C_family 99..199 CDD:198286 29/116 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.