Sequence 1: | NP_611323.1 | Gene: | GstE1 / 37106 | FlyBaseID: | FBgn0034335 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314691.1 | Gene: | gstt1a / 563972 | ZFINID: | ZDB-GENE-031001-13 | Length: | 242 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 68/197 - (34%) |
---|---|---|---|
Similarity: | 105/197 - (53%) | Gaps: | 25/197 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 PCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVD 79
Fly 80 KYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGV------TEVPQEKLDA--- 135
Fly 136 -VHQGLKLLE-TFLGNSPYLAGDSLTLADLSTGPTVSAV----PAAVDIDP-ATYPKVTAWLDRL 193
Fly 194 NK 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE1 | NP_611323.1 | GST_N_Delta_Epsilon | 6..79 | CDD:239343 | 24/63 (38%) |
GstA | 8..197 | CDD:223698 | 68/197 (35%) | ||
GST_C_Delta_Epsilon | 94..210 | CDD:198287 | 38/118 (32%) | ||
gstt1a | NP_001314691.1 | GstA | 3..199 | CDD:223698 | 67/194 (35%) |
GST_N_Theta | 3..78 | CDD:239348 | 24/65 (37%) | ||
GST_C_Theta | 91..217 | CDD:198292 | 38/118 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.820 |