DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gstt1a

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:197 Identity:68/197 - (34%)
Similarity:105/197 - (53%) Gaps:25/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVD 79
            || |:|.:..|:..:.:|||.|:|.|||...:|:.|.:....||.|.|....:.:|.||..||..
Zfish    13 PC-RSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTESIAILLYLAG 76

  Fly    80 KYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGV------TEVPQEKLDA--- 135
            |::..|..||.||.|||.|::.|.:..:.|.   ::.|:.||..||      ..||:||:|:   
Zfish    77 KHSTPDHWYPADLQKRAQVDEFLSWQHTNIR---SHGSKVFWFKGVLPAVTGAPVPKEKMDSALE 138

  Fly   136 -VHQGLKLLE-TFLGNSPYLAGDSLTLADLSTGPTVSAV----PAAVDIDP-ATYPKVTAWLDRL 193
             ::..||:.| .||.:.|::.||.::|||:     |:.|    |.|..:|. ...|.::||.||:
Zfish   139 DLNMSLKIFEDKFLQSRPFIIGDKISLADI-----VAIVEMMQPVATGVDVFEGRPALSAWRDRV 198

  Fly   194 NK 195
            .|
Zfish   199 KK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 24/63 (38%)
GstA 8..197 CDD:223698 68/197 (35%)
GST_C_Delta_Epsilon 94..210 CDD:198287 38/118 (32%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 67/194 (35%)
GST_N_Theta 3..78 CDD:239348 24/65 (37%)
GST_C_Theta 91..217 CDD:198292 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.