DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:272 Identity:49/272 - (18%)
Similarity:94/272 - (34%) Gaps:72/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTF 66
            |...:|||....|...:.|:|.:....|..|.::|:|...|.....:::.|....||:.....|.
Zfish    44 SKDRLVLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTI 108

  Fly    67 IWDSHAIAAYL-----------------------VDKYAKSDELYPKD-LAKRAIVNQRLFFDAS 107
            :.|.:.|..|:                       |.:|.:..:..|.| .....|::..|..|:.
Zfish   109 VSDYNQIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSM 173

  Fly   108 VIYASIANVSRPFWINGVTEV----------------PQEKLDAV---HQGLKLLETFLGN---- 149
            :...:.|.:.|.. .|..:|:                .|:||.|.   |..:..|:..||.    
Zfish   174 IPKYATAEIRRHL-ANAASELMKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKKILGELAMV 237

  Fly   150 --------------------SPYLAGDSLTLADLSTGPTVSAVP----AAVDIDPATYPKVTAWL 190
                                ..:|.|.:.||||:..|.|:..:.    :....:..:.|.:.::.
Zfish   238 LDQVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRLKFLGLSRKYWEDGSRPNLQSFF 302

  Fly   191 DRLNKLPYYKEI 202
            :|:.|...::::
Zfish   303 ERVQKRYAFRKV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 18/95 (19%)
GstA 8..197 CDD:223698 47/259 (18%)
GST_C_Delta_Epsilon 94..210 CDD:198287 26/156 (17%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 48/266 (18%)
Thioredoxin_like 48..120 CDD:294274 18/71 (25%)
GST_C_GDAP1L1 201..311 CDD:198335 19/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.