Sequence 1: | NP_611323.1 | Gene: | GstE1 / 37106 | FlyBaseID: | FBgn0034335 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061845.2 | Gene: | GDAP1 / 54332 | HGNCID: | 15968 | Length: | 358 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 47/232 - (20%) |
---|---|---|---|
Similarity: | 77/232 - (33%) | Gaps: | 70/232 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDS 70
Fly 71 HAIAAYLVDKYA----------KSDELYPKDLAKR--------------AIVNQRLFFDASV--- 108
Fly 109 ----IYASIANVS-------------RPFWINGVTEVPQEKLDAVHQGLKLLETFL--------- 147
Fly 148 ---------------GNSPYLAGDSLTLADLSTGPTV 169 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE1 | NP_611323.1 | GST_N_Delta_Epsilon | 6..79 | CDD:239343 | 19/72 (26%) |
GstA | 8..197 | CDD:223698 | 47/230 (20%) | ||
GST_C_Delta_Epsilon | 94..210 | CDD:198287 | 25/134 (19%) | ||
GDAP1 | NP_061845.2 | GST_N_GDAP1 | 26..98 | CDD:239350 | 18/71 (25%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 18/79 (23%) | ||
Required for mitochondrial localization | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154575 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |