DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gsto2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:223 Identity:53/223 - (23%)
Similarity:99/223 - (44%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLD-DNGTFIWD 69
            |.||.....|..:..:|.|....:.::...:||.:   ..:.::||||..|||:|: .:|..|::
Zfish    23 IRLYSMRFCPFAQRTRLVLTAKGVKHDIININLVS---KPDWFLKKNPFGTVPVLETSSGQVIYE 84

  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWI-------NGVTE 127
            |.....||.:.|.:. :|.|.|..:||  .|::..:   :|:.:.    |::.       .| .:
Zfish    85 SPITCEYLDEVYPEK-KLLPSDPFERA--QQKMLLE---LYSKVI----PYFYKISMGKKRG-ED 138

  Fly   128 VPQEKLDAVHQGLKLLETFLGN--SPYLAGDSLTLADLSTGPTVS-AVPAAVDIDPATYPKVTAW 189
            |...:.:...:.|:|.|. |.|  :.|..|||:|:.|....|... |....|....|..|::..|
Zfish   139 VSTAEAEFTEKLLQLNEA-LANKKTKYFGGDSITMIDYLIWPWFERAEMMGVKHCLAKTPELRKW 202

  Fly   190 LDRLNKLPYYK------EINEAPAQSYV 211
            ::.:.:.|..|      ::::....||:
Zfish   203 IELMFEDPVVKATMFNTDVHKVFFDSYM 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/73 (29%)
GstA 8..197 CDD:223698 48/199 (24%)
GST_C_Delta_Epsilon 94..210 CDD:198287 26/131 (20%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 20/72 (28%)
GstA 25..210 CDD:223698 48/199 (24%)
GST_C_Omega 107..229 CDD:198293 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.