DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstD5

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:189 Identity:78/189 - (41%)
Similarity:101/189 - (53%) Gaps:4/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLV 78
            |.| |||.:..|.|.:....|.:|....:.|..|:||.|||||:|.|.|||..||:|.|||.|||
  Fly    10 SGC-RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLV 73

  Fly    79 DKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLL 143
            :||.|.|.|:|||..|:|:|||||:||...:|.|.|....|.:..| .....|....:....:.|
  Fly    74 EKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTG-KPGSDEDFKKIESSFEYL 137

  Fly   144 ETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKL-PYYKE 201
            ..||....|:|||.||:||::...|||.. ...|.|...||.|..|.....|: |.::|
  Fly   138 NIFLEGQNYVAGDHLTVADIAILSTVSTF-EIFDFDLNKYPNVARWYANAKKVTPGWEE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 31/64 (48%)
GstA 8..197 CDD:223698 76/183 (42%)
GST_C_Delta_Epsilon 94..210 CDD:198287 38/109 (35%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 75/176 (43%)
GST_N_Delta_Epsilon 1..74 CDD:239343 31/64 (48%)
GST_C_Delta_Epsilon 88..204 CDD:198287 38/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460232
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.