DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstD3

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:178 Identity:71/178 - (39%)
Similarity:105/178 - (58%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYP 89
            |.|.|::..|.:|...||.::.:::|.||||::|.|.|||..||:|.||..|||:||.|.|.|||
  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68

  Fly    90 KDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLA 154
            ||:.|:|::||||:||.:::|.::||.....:..|... .:|....|.:....|.|||....|:|
  Fly    69 KDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFG-SEEDYKKVQETFDFLNTFLEGQDYVA 132

  Fly   155 GDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKL-PYYKE 201
            ||..|:||::....||... .|..|.:.||.|..|.|.:.|: |.::|
  Fly   133 GDQYTVADIAILANVSNFD-VVGFDISKYPNVARWYDHVKKITPGWEE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 24/53 (45%)
GstA 8..197 CDD:223698 69/172 (40%)
GST_C_Delta_Epsilon 94..210 CDD:198287 37/109 (34%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 24/53 (45%)
GstA 6..173 CDD:223698 67/168 (40%)
GST_C_Delta_Epsilon 72..188 CDD:198287 37/110 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460349
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.