DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstD2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:179 Identity:77/179 - (43%)
Similarity:100/179 - (55%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYA 82
            |||.:..|.|.|:...|.:|...||.|..|:||.|||||:|.|.|||..||:|.|||.|||:||.
  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77

  Fly    83 KSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFL 147
            |.|.|.|.|..|||::||||:||...:|.|.|....|.:..| .....|.|..:......|:|||
  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTG-KPGSDEDLKRIETAFGFLDTFL 141

  Fly   148 GNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKL 196
            ....|:|||.||:||::...|||....: :.|.:.|..|:.|.|...|:
  Fly   142 EGQEYVAGDQLTVADIAILSTVSTFEVS-EFDFSKYSNVSRWYDNAKKV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 32/60 (53%)
GstA 8..197 CDD:223698 77/179 (43%)
GST_C_Delta_Epsilon 94..210 CDD:198287 37/103 (36%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 32/60 (53%)
GST_C_Delta_Epsilon 88..204 CDD:198287 37/104 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460258
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.