DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gsto1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:226 Identity:53/226 - (23%)
Similarity:95/226 - (42%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLD-DNGTFIWD 69
            |.||.....|..:..:|.|....:.|:...:||   ::..:.:::|||...||:|: .:|..|::
Zfish    23 IRLYSMRFCPFAQRTRLVLNAKGIKYDTININL---KNKPDWFLEKNPLGLVPVLETQSGQVIYE 84

  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLD 134
            |.....||.:.|.:. :|.|.|..:||  .||:..:.      .:.|:..|:...|.....|.:.
Zfish    85 SPITCEYLDEVYPEK-KLLPFDPFERA--QQRMLLEL------FSKVTPYFYKIPVNRTKGEDVS 140

  Fly   135 AVHQGLK---------LLETFLGNSPYLAGDSLTLADLSTGPTVSAVPA-----AVDIDPATYPK 185
            |:...||         ||:.   .|.:..|||:|:.|....|....:..     .:|    ..|:
Zfish   141 ALETELKDKLSQFNEILLKK---KSKFFGGDSITMIDYMMWPWFERLETMNLKHCLD----GTPE 198

  Fly   186 VTAWLDRLNKLPYYKEINEAPAQSYVAFLRS 216
            :..|.:|:.:.|..| ......::|:.|.:|
Zfish   199 LKKWTERMMEDPTVK-ATMFSTETYMVFYKS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 20/73 (27%)
GstA 8..197 CDD:223698 47/203 (23%)
GST_C_Delta_Epsilon 94..210 CDD:198287 26/129 (20%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 19/72 (26%)
GstA 25..210 CDD:223698 47/203 (23%)
GST_C_Omega 107..229 CDD:198293 29/138 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.