DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstD9

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:208 Identity:80/208 - (38%)
Similarity:110/208 - (52%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSH 71
            :||.   :|| |::.:|.:.|.|:...|:|:|.|||||..|:||.|||||:|.|.|:|..||:|.
  Fly     7 MLYS---APC-RSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESR 67

  Fly    72 AIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTE-VPQEKLDA 135
            ||..||.:||.|...|||||..:||::|||||||.|.:|.|......|.....|.: ...:.|..
  Fly    68 AILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKK 132

  Fly   136 VHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKL---- 196
            :.....:..|.|....|.|.:.|||||.:...|||....: :.|...||:|..|.|...|:    
  Fly   133 IDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEIS-EYDFGKYPEVVRWYDNAKKVIPGW 196

  Fly   197 -------PYYKEI 202
                   .|||::
  Fly   197 EENWEGCEYYKKL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 35/71 (49%)
GstA 8..197 CDD:223698 77/200 (39%)
GST_C_Delta_Epsilon 94..210 CDD:198287 37/121 (31%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 35/71 (49%)
GstA 4..187 CDD:223698 75/184 (41%)
GST_C_Delta_Epsilon 89..207 CDD:198287 35/118 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460297
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_103768
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.