DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstZ2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:216 Identity:63/216 - (29%)
Similarity:99/216 - (45%) Gaps:27/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSGI--VLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNL--QAGEHLSEEYVKKNPQHTVPMLDD 62
            |||.|  :||....|.|...|::.:.:..:.|:.|.::|  ..||....||.:.||...||.|..
  Fly    10 SSSDIQPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQI 74

  Fly    63 NGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTE 127
            :|..:.:|.||..|| ::......|.|:|:.|||.|.:.:    .:|.:.|..:.....:..|.|
  Fly    75 DGHTLIESVAIMHYL-EETRPQRPLLPQDVHKRAKVREIV----EIICSGIQPLQNLIVLIHVGE 134

  Fly   128 VPQEKLDAVH---QGLKLLETFLGNS--PYLAGDSLTLADLSTGPTV-SAVPAAVDIDPATYPKV 186
             .::|..|.|   :|.:.:|..|..|  .|..||.:::||....|.| :|....||:.|  || :
  Fly   135 -EKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRP--YP-I 195

  Fly   187 TAWLDRLNKLPYYKEINEAPA 207
            ...:||        |:...||
  Fly   196 ILRIDR--------ELESNPA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 24/76 (32%)
GstA 8..197 CDD:223698 56/196 (29%)
GST_C_Delta_Epsilon 94..210 CDD:198287 33/120 (28%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 23/74 (31%)
maiA 17..221 CDD:273527 59/209 (28%)
GST_C_Zeta 104..217 CDD:198300 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.