DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and clic5b

DIOPT Version :10

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:220 Identity:53/220 - (24%)
Similarity:77/220 - (35%) Gaps:74/220 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKY 81
            |.||.|..|..:|.      ||..|.|             .|.|..||....|.:.|..:|.:..
Zfish   209 VTTVDLKRKPADLH------NLAPGTH-------------PPFLTFNGEVKTDVNKIEEFLEEVL 254

  Fly    82 AKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQG----LKL 142
            |...  ||| ||.|...:.....|....:::....::|           :..:|:.:|    ||.
Zfish   255 APPK--YPK-LAARHRESNAAGNDIFAKFSAFIKNTKP-----------DANEALEKGLTKALKK 305

  Fly   143 LETFLGNSP-------------------YLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTA 188
            |:.:| |||                   :|.|:.|||||.:..|.:..|            ||.|
Zfish   306 LDEYL-NSPLPDEVDADSMEEEKASNRRFLDGNDLTLADCNLLPKLHIV------------KVVA 357

  Fly   189 WLDRLNKLP-----YYKEINEAPAQ 208
            ...|...:|     .::.:|.|.||
Zfish   358 KKYRNFDIPSDLTGVWRYLNSAYAQ 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GstA 6..201 CDD:440390 49/211 (23%)
clic5bNP_998062.1 EFh_CREC <53..150 CDD:330175
EF-hand motif 81..119 CDD:320021
EF-hand motif 126..150 CDD:320021
O-ClC 172..407 CDD:129941 53/220 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.