DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstO2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:223 Identity:52/223 - (23%)
Similarity:88/223 - (39%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLD-----DNGTFIWDSHAIA 74
            |....|:|.|...::::....|:|   ....|.|...:|...||.|.     |..|.: :|..||
  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDL---IEKPEWYKDFSPLGKVPALQLTGVKDQPTLV-ESLIIA 92

  Fly    75 AYLVDKYAKSDELYPKDLAKRA---IVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAV 136
            .||..:|.:: .|:|.|..::|   |:.:|.....|.||..:  ...|       ..|::.:...
  Fly    93 EYLDQQYPQT-RLFPTDPLQKALDKILIERFAPVVSAIYPVL--TCNP-------NAPKDAIPNF 147

  Fly   137 HQGLKLLETFLG--NSPYLAGDSLTLADLSTGPTVSAVPA-------AVDIDPATYPKVTAWLDR 192
            ...|.:.|..||  .:||.||..:.:.|....|.....|:       ..::|...:.|:..|.|.
  Fly   148 ENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKWRDL 212

  Fly   193 LNKLPYYKEINEAPA---QSYVAFLRSK 217
            :.:    .|:.:..|   |.:..|.:||
  Fly   213 MTQ----DEVVQKTALDVQLHAEFQKSK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 19/68 (28%)
GstA 8..197 CDD:223698 46/198 (23%)
GST_C_Delta_Epsilon 94..210 CDD:198287 26/130 (20%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 18/67 (27%)
GstA 25..215 CDD:223698 46/196 (23%)
GST_C_Omega 110..235 CDD:198293 27/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.