DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstO3

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:229 Identity:54/229 - (23%)
Similarity:89/229 - (38%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSGIV-LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPML---- 60
            :...|:: ||.....|..:...|.|...|:.|....:||   ....|..|:.:|...||.|    
  Fly    16 LPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINL---TEKPEWLVEVSPLLKVPALQLVA 77

  Fly    61 DDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRA---IVNQRLFFDASVIYASIANVSRPFWI 122
            :.....:.:|..||.||.|||.: :.|.|||..|||   |:.:|        ::||.:......:
  Fly    78 EKGEPSLIESLIIAEYLDDKYPE-NPLLPKDPLKRAQDKILLER--------FSSITSAFINILV 133

  Fly   123 NGVTEVPQEKLDAVHQGLKLLETFL--GNSPYLAGDSLTLADLSTGP---TVSAVPAAV----DI 178
            .|.      .|:.....|.:.|..|  ..:||..|:.....|....|   .:|.:...:    :.
  Fly   134 QGT------GLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNF 192

  Fly   179 DPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVA 212
            :.:.:||:|.|:..|..        ::..||:.|
  Fly   193 NESRFPKITKWIALLKA--------DSVVQSFYA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 20/77 (26%)
GstA 8..197 CDD:223698 50/204 (25%)
GST_C_Delta_Epsilon 94..210 CDD:198287 24/127 (19%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 20/81 (25%)
GstA 22..209 CDD:223698 50/204 (25%)
GST_C_Omega 109..230 CDD:198293 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.