DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstE12

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:211 Identity:90/211 - (42%)
Similarity:126/211 - (59%) Gaps:1/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            ||...|||..|.|.||.|.:.||.|.:.:||..||||:.|::|.|||||:|.|.|....|.||||
  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70

  Fly    73 IAAYLVDKYA-KSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAV 136
            |.||||:||. |..:||||:|.:||.|:.||..|:..::|.:..:..|....|.|:...:|:..:
  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYI 135

  Fly   137 HQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKE 201
            .:..::||.||.:.|||.|..||:||.....||::|.....||...:||:.|||.||.:||||:|
  Fly   136 QKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPYYQE 200

  Fly   202 INEAPAQSYVAFLRSK 217
            :|...|....:..::|
  Fly   201 VNGDGADELKSIFKAK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 38/70 (54%)
GstA 8..197 CDD:223698 82/189 (43%)
GST_C_Delta_Epsilon 94..210 CDD:198287 42/115 (37%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 38/70 (54%)
GstA 6..201 CDD:223698 86/194 (44%)
GST_C_Delta_Epsilon 92..210 CDD:198287 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468016
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.