powered by:
Protein Alignment GstE1 and Gr59f
DIOPT Version :9
Sequence 1: | NP_611323.1 |
Gene: | GstE1 / 37106 |
FlyBaseID: | FBgn0034335 |
Length: | 224 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_788432.1 |
Gene: | Gr59f / 37726 |
FlyBaseID: | FBgn0041234 |
Length: | 406 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 9/43 - (20%) |
Similarity: | 21/43 - (48%) |
Gaps: | 4/43 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 LFFD----ASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGL 140
:||: ..|:|.||.:::.....|.::.:...:...:.||:
Fly 168 IFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGI 210
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.