DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstE8

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:213 Identity:101/213 - (47%)
Similarity:146/213 - (68%) Gaps:1/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIW 68
            |.::||||:.||.||..||||..|.:.|||.::|..|.|.||.|:::||||||||.|:|:|.|||
  Fly     2 SKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIW 66

  Fly    69 DSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYAS-IANVSRPFWINGVTEVPQEK 132
            |||||:||||.||.:||.||||||.:||:|:|||.|::.|::.: :..:::|.:..|.|.:|:|:
  Fly    67 DSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKER 131

  Fly   133 LDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLP 197
            .|||.:....:||||....::|||.||:||.|...:::|:...|.||...|..:|||:.|:.:||
  Fly   132 YDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEELP 196

  Fly   198 YYKEINEAPAQSYVAFLR 215
            ||:|.....|:..|..|:
  Fly   197 YYEEACGKGARDLVTLLK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 44/72 (61%)
GstA 8..197 CDD:223698 92/189 (49%)
GST_C_Delta_Epsilon 94..210 CDD:198287 43/116 (37%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 92/191 (48%)
GST_N_Delta_Epsilon 4..77 CDD:239343 44/72 (61%)
GST_C_Delta_Epsilon 91..209 CDD:198287 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467967
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.900

Return to query results.
Submit another query.