DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstE5

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:212 Identity:105/212 - (49%)
Similarity:147/212 - (69%) Gaps:1/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDS 70
            :.|||.:.||.||.|||||..|.|.||:..||:...|.|||||:||||:||||.|:|:|.:||||
  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68

  Fly    71 HAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYAS-IANVSRPFWINGVTEVPQEKLD 134
            |||.||||.|||.||.|||:||.:||:|:|||.|:..|::|: |..:::|.:.||:..:|:|:.|
  Fly    69 HAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYD 133

  Fly   135 AVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYY 199
            |:.:....:||||....|:|||.||:||.|...:::::.|.|:||...||::..|:.||.|||||
  Fly   134 AIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLPYY 198

  Fly   200 KEINEAPAQSYVAFLRS 216
            :|.|...|:.....|:|
  Fly   199 EEANAKGARELETILKS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 45/72 (63%)
GstA 8..197 CDD:223698 96/189 (51%)
GST_C_Delta_Epsilon 94..210 CDD:198287 47/116 (41%)
GstE5NP_611327.1 GstA 4..196 CDD:223698 96/191 (50%)
Thioredoxin_like 4..77 CDD:294274 45/72 (63%)
GST_C_Delta_Epsilon 91..209 CDD:198287 47/117 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467975
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.900

Return to query results.
Submit another query.