DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstE10

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:223 Identity:106/223 - (47%)
Similarity:149/223 - (66%) Gaps:2/223 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIW 68
            :.::||||:.||.||.|.|||:.|.||:|:..:::|||:||..:.::||||||||||:|..:.||
  Fly     2 ANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIW 66

  Fly    69 DSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASI-ANVSRPFWINGVTEVPQEK 132
            |||||..|||:|||:||||||||..|||:|:|||.|:..|::..| ..:.|..:....||||:::
  Fly    67 DSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDR 131

  Fly   133 LDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAA-VDIDPATYPKVTAWLDRLNKL 196
            |..:.....|||.||..:||:||..||:||.|...|||.:..: ..:|...|||::|||.|::.|
  Fly   132 LAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISAL 196

  Fly   197 PYYKEINEAPAQSYVAFLRSKWTKLGDK 224
            |:|:|.|...|:.....:|||..|..||
  Fly   197 PFYEEDNLRGARLLADKIRSKLPKQFDK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 41/72 (57%)
GstA 8..197 CDD:223698 94/190 (49%)
GST_C_Delta_Epsilon 94..210 CDD:198287 47/117 (40%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 94/192 (49%)
GST_N_Delta_Epsilon 4..77 CDD:239343 41/72 (57%)
GST_C_Delta_Epsilon 91..211 CDD:198287 47/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467984
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.900

Return to query results.
Submit another query.