DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and clic4

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:183 Identity:40/183 - (21%)
Similarity:60/183 - (32%) Gaps:65/183 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVD-- 79
            |.||.|..|..:|.      ||..|.|             .|.:..||....|.:.|..||.|  
Zfish    53 VTTVDLKRKPADLQ------NLAPGTH-------------PPFITFNGEVKTDVNKIEEYLEDIL 98

  Fly    80 ---KYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGL- 140
               ||:|....:|:        :.....|....:::....|:|           :..:|:.:|| 
Zfish    99 CPPKYSKLGARHPE--------SNTAGMDIFAKFSAFIKNSKP-----------DANEALERGLL 144

  Fly   141 ----KLLETFLGNSP-----------------YLAGDSLTLADLSTGPTVSAV 172
                ||.|......|                 :|.|:.:||||.:..|.:..|
Zfish   145 KTLQKLDEYLCSPLPDEIDHNSMEEVKASTRMFLDGEEMTLADCNLLPKLHIV 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 17/61 (28%)
GstA 8..197 CDD:223698 40/183 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 18/101 (18%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359 18/68 (26%)
O-ClC 16..250 CDD:129941 40/183 (22%)
GST_C_CLIC4 110..250 CDD:198329 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.