DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstE14

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:206 Identity:65/206 - (31%)
Similarity:106/206 - (51%) Gaps:13/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGT 65
            ||....:||..:.||.||:..:.:|:|::|.|.:.|||..||...::::..||||:||.|.....
  Fly     1 MSQPKPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDL 65

  Fly    66 FIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQ 130
            .:.|||||..:|.:|:.:...|:|::.|:|..|...|.|:.|.::...::........|...|  
  Fly    66 VLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANV-- 128

  Fly   131 EKLDAVHQGLKL------LETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAW 189
               |..|...||      :|.:|.||.::||..|||||||...|:|.|.....:  :.:|::..|
  Fly   129 ---DVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL--SQFPRLRRW 188

  Fly   190 LDRLNKLPYYK 200
            ...:.:|..|:
  Fly   189 FTAMQQLDAYE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 28/72 (39%)
GstA 8..197 CDD:223698 61/194 (31%)
GST_C_Delta_Epsilon 94..210 CDD:198287 31/113 (27%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 63/201 (31%)
GST_N_Delta_Epsilon 6..79 CDD:239343 28/72 (39%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.