DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstT1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:220 Identity:62/220 - (28%)
Similarity:101/220 - (45%) Gaps:16/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFI 67
            |..|..|...||...|.:.:.:|:....:|...|.|:..|.|::||...|....||.:.|....:
  Fly     2 SKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQL 66

  Fly    68 WDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWI---NGVTEVP 129
            .:|.:|..||.||...|::||||.|.:||.|::.|.:....:....:...|..|:   .|:...|
  Fly    67 GESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAP 131

  Fly   130 QEK-----LDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVP-AAVDIDPATYPKVTA 188
            :.:     :..|...|.|||.......:|.||.||:||:.....::.:. ...:::...:|||..
  Fly   132 KPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAK 196

  Fly   189 WLDRLNKL--PYYKEINEAPAQSYV 211
            |::|:...  |||.|     |.|:|
  Fly   197 WMERVRDATNPYYDE-----AHSFV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/72 (29%)
GstA 8..197 CDD:223698 53/199 (27%)
GST_C_Delta_Epsilon 94..210 CDD:198287 30/126 (24%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 54/198 (27%)
GST_N_Theta 5..80 CDD:239348 22/74 (30%)
GST_C_Theta 93..218 CDD:198292 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460106
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.