DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstT3

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:220 Identity:64/220 - (29%)
Similarity:99/220 - (45%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKK-NPQHTVPMLDDNGTF 66
            |:.|..|...:|...|.:.:..::.|:.:|...|.|:.||||:|::.|: |....||.:.|||..
  Fly    42 SAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYK 106

  Fly    67 IWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVT--EVP 129
            :.:|.||..||..|....:.||||....::.|::.|.:....:..:.|...|..|:..:.  ..|
  Fly   107 LAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTP 171

  Fly   130 QE------------KLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDID-PA 181
            .|            .||.|.      |.:|....:|.|.|||:||:.....:.....| |.| ..
  Fly   172 SEAKIETFRMQMERNLDVVE------EVWLEGKDFLTGSSLTVADIFAACEIEQTRMA-DYDVRI 229

  Fly   182 TYPKVTAWLDRLNKL--PYYKEINE 204
            .|||:.|||.|:.:.  |||...:|
  Fly   230 KYPKIRAWLKRVRQSCNPYYDVAHE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 25/73 (34%)
GstA 8..197 CDD:223698 58/206 (28%)
GST_C_Delta_Epsilon 94..210 CDD:198287 33/128 (26%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 25/75 (33%)
GstA 47..243 CDD:223698 58/202 (29%)
GST_C_Theta 135..259 CDD:198292 33/127 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460080
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.